PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_190450_tjmp.t1
Common NameSOVF_190450
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family GRF
Protein Properties Length: 582aa    MW: 62832.4 Da    PI: 7.4587
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_190450_tjmp.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC794.4e-25222265144
                WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                        d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e
  Sp_190450_tjmp.t1 222 DPEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRHRSRKPVE 265
                        79***************************************998 PP

2QLQ63.17.5e-22152188137
                QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                        ++FT+aQ+ +L++Q+++yKyL an+PvP++Ll +i+k
  Sp_190450_tjmp.t1 152 GPFTPAQWIELEHQAMIYKYLTANVPVPHNLLIPIRK 188
                        59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.2E-12152188IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.849153188IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.0E-15153187IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.954222266IPR014977WRC domain
PfamPF088793.9E-21223265IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 582 aa     Download sequence    Send to blast
MDFGLVGSVD SSEQQQILEG KPNGSGLLIK QERPDPFGDE DNNRAAKMVK RGQDLGLRSD  60
NNNVNVLPKQ QMLSFSSSNK PQQLSFLGSK DVGFIAADNN NNNNNNNNTN AQNLFLSYFQ  120
HQPPPPSAPN YSRTPAGNLN GNMHGSFTGI RGPFTPAQWI ELEHQAMIYK YLTANVPVPH  180
NLLIPIRKAL CSSVFPGFSI GSYPPHSYGW GAFHLGFSGN TDPEPGRCRR TDGKKWRCSR  240
DAVPDQKYCE RHINRGRHRS RKPVEGLTGQ AASGPTNTKE VPAMSMPSSL VTSSGGASNS  300
STVTIAHHHH HVKPLQPSGA TNATTDSIVN RFHDEQGLSV SVMPPPTTMN LKTNDTSFSL  360
DDSSQSEFGL VSTDSLLNPT QKSYNNSSSS SSILGFNSQQ TQDQQYPLRH FMDVWPKDNS  420
TRSTIPWPED LKSDWTQLSM SIPNQENKTA VSPLRLSREL DPSETGLGLD ETGMKQQNAW  480
IPISWGNNNN NNNSMGGPLG EVLNNTSKNI MTSALNLKGS DQRCGGGGGG GSPQLGSSPT  540
GVLQKSTYVS LSNSSSAEGG ASPCDDIFGL AAHASSTFVP SM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010679671.10.0PREDICTED: growth-regulating factor 2-like
SwissprotO810011e-104GRF1_ARATH; Growth-regulating factor 1
TrEMBLA0A0K9QFT00.0A0A0K9QFT0_SPIOL; Uncharacterized protein
STRINGVIT_00s0494g00010.t011e-157(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.11e-101growth-regulating factor 1